PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.30275s0218.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GATA
Protein Properties Length: 515aa    MW: 57631.9 Da    PI: 8.0129
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.30275s0218.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.13.7e-16741135
                  GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                          C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Bostr.30275s0218.1.p  7 CYHCGVTNTPLWRNGPPEKPVLCNACGSRWRTKGT 41
                          ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.0E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.09E-11546No hitNo description
CDDcd002022.31E-16651No hitNo description
PfamPF003204.9E-14741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.9E-12741IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.095740IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139193.2E-10269363IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MGKQGPCYHC GVTNTPLWRN GPPEKPVLCN ACGSRWRTKG TLVNYTPLHA RADGDENDDH  60
HRFQRMKSIS VSNKNKDTKM LKRKAIQENI IIKRPVLEFN YGLKKGVIEE DASNRSSSGS  120
AVSNSESCAQ FSRADGSPSQ SNAWDTTVPC KRRTCVGRPK SSSVEKLTKD LYNILQEQQS  180
SCLSVSSEED LLFENEMSMV SVEIGHGSVL MKNPHSFARE EESEASSISS IENKSSISEA  240
YSHSVKRVEM GAERGSYYGG QAIKQEQFKR TKSQTERVHV LGSHSSPLCS INLKDVFNFD  300
EFIEQFTEEE QKKLMKLLPQ IDSDNLPDSL RMMFESAQFK DNFSLFKQLI ADGVFDMSSS  360
SGAKLEDIRT FKKLALTDFN KSRLVESYYL LKEREKERGD SVTTTSKISN PNVPKNIVTI  420
KRRCEDQTQL KSESRGLMRS PKRVMKMKVT DESKVMTENN VSCFSPRSLA SVFGQEGGSA  480
VFGYEGNCSS DQDLLLLDLP SNGSFPQAEL LHQL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0625620.0AY062562.1 Arabidopsis thaliana Unknown protein (Z97343.42) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285659.10.0hypothetical protein CARUB_v10007115mg
SwissprotQ8W4H10.0GAT26_ARATH; GATA transcription factor 26
TrEMBLR0F9D00.0R0F9D0_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.7__2553__AT4G17570.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16062785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.10.0GATA transcription factor 26